PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013619674.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 487aa    MW: 55271.3 Da    PI: 7.5147
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013619674.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.84.5e-17241287148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT +Ed ll ++v ++G+++W+ Ia++++ gR +kqc++rw+++l
   XP_013619674.1 241 KGQWTSDEDRLLMQLVVLHGTKRWSQIAKMLQ-GRVGKQCRERWHNHL 287
                      799*****************************.*************97 PP

2Myb_DNA-binding54.62.6e-17294335245
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      + W++eEd +l++a+k+ G++ W+ Iar+++ gRt++ +k++w+
   XP_013619674.1 294 DGWSEEEDRILIEAHKEIGNR-WAEIARKLP-GRTENTIKNHWN 335
                      56*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129429.224236291IPR017930Myb domain
SuperFamilySSF466897.86E-31238334IPR009057Homeodomain-like
SMARTSM007173.2E-15240289IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.8E-27242295IPR009057Homeodomain-like
CDDcd001671.02E-13244287No hitNo description
PfamPF139211.3E-17244301No hitNo description
SMARTSM007172.7E-16292340IPR001005SANT/Myb domain
PROSITE profilePS5129420.836292342IPR017930Myb domain
CDDcd001675.25E-13296338No hitNo description
Gene3DG3DSA:1.10.10.605.0E-21296340IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010439Biological Processregulation of glucosinolate biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1904095Biological Processnegative regulation of endosperm development
GO:2000692Biological Processnegative regulation of seed maturation
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 487 aa     Download sequence    Send to blast
MEFQSVIKMH YPYLASVIFD DNFSLKDVHP SLTDDASCVQ NVHHKPFHAK LDKSHVPSII  60
NPDLCHKNLT LNISNTTFDH IPNLNISPRH YDMQPHIFDT VSKDIYNGIT PSPCTEAFEA  120
YLRGISNDQD LFDMACNTSS QHVEPNDVPN ISHVPRDNTM WENNQNQGII FGTESIFNLA  180
MVDSNLYGAP KPIGILGANE DTIMNQRHNN QIMIKVDQIK KSKRFQMRRG SKLTRKASII  240
KGQWTSDEDR LLMQLVVLHG TKRWSQIAKM LQGRVGKQCR ERWHNHLRPD IKKDGWSEEE  300
DRILIEAHKE IGNRWAEIAR KLPGRTENTI KNHWNATKRK QHSRKSKGKD EVSLALGSNT  360
LQNYIRSVTY NDDTLMTATS NSNGNNGRRN VRGKGKNVIV DASDYNKKND ENECKYIVDG  420
VMNLDLEKST ICVSRSTSAS GSTSGSGSGV TMEVDEPMED SWMVMHGCDE VMMNEIALLE  480
MIARGHV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C5e-442393412104C-Myb DNA-Binding Domain
1mse_C5e-442393412104C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00385DAPTransfer from AT3G27785Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0181146e-36AB018114.1 Arabidopsis thaliana genomic DNA, chromosome 3, P1 clone: MGF10.
GenBankAF3348176e-36AF334817.2 Arabidopsis thaliana putative transcription factor (MYB118) mRNA, complete cds.
GenBankAY5503066e-36AY550306.1 Arabidopsis thaliana MYB transcription factor (At3g27785) mRNA, complete cds.
GenBankCP0026866e-36CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence.
GenBankDQ4467086e-36DQ446708.1 Arabidopsis thaliana clone pENTR221-At3g27785 myb family transcription factor (At3g27785) mRNA, complete cds.
GenBankDQ6531116e-36DQ653111.1 Arabidopsis thaliana clone 0000013325_0000009613 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013619674.10.0PREDICTED: uncharacterized protein LOC106326201 isoform X1
TrEMBLA0A0D3AWA40.0A0A0D3AWA4_BRAOL; Uncharacterized protein
STRINGBra033027.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM60522643
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27785.10.0myb domain protein 118